Protein Info for BBR_RS19500 in Bifidobacterium breve UCC2003

Annotation: fuconate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 PF02746: MR_MLE_N" amino acids 35 to 137 (103 residues), 41.5 bits, see alignment E=1.4e-14 PF13378: MR_MLE_C" amino acids 202 to 416 (215 residues), 185.7 bits, see alignment E=9.7e-59

Best Hits

Swiss-Prot: 54% identical to FUCD_XANCP: L-fuconate dehydratase (XCC4069) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: None (inferred from 100% identity to bll:BLJ_1837)

MetaCyc: 54% identical to L-fuconate dehydratase monomer (Xanthomonas campestris pv. campestris)
L-fuconate dehydratase. [EC: 4.2.1.68]

Predicted SEED Role

"L-fuconate dehydratase (EC 4.2.1.68)" in subsystem L-fucose utilization temp (EC 4.2.1.68)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>BBR_RS19500 fuconate dehydratase (Bifidobacterium breve UCC2003)
MSTITKVKTYDFRFPTSTTLSGSDAMNPDPDYSSAYVEISTSADDGITGVGFVFTIGRGN
DVVCKAIESMSQVLIGRNTEELLDNMRIAWDLFVHDSQLRWLGPEKGVEHMAIGAVLSAL
WDIKAKRAGKPLWLLLGEMEPEELVSTLDFRYMTDALRPEEAVAILKEGQKGKAERIKHL
LEVGYPGYSTAPGWLGYSDEKMVALAKEETQVKGFKQIKLKVGQNINDDLRRLSKAREAI
GPDVRLAVDANQVWDVPTAIDWINKFHDFDLAWVEEPTSPDDVIGHATIARAINPIKVAT
GEQMQSRILYKQYLQANAFGIMQIDATRVAGPQEIVLEYLLAKKFNKPVCPHAGGVGLCE
AVCHFAMFDYVAVSGTMDGRMIEYVDNQHEHFVHPTEIKDGNYVAPTAPGNGTEMTLETA
EKYLYRC