Protein Info for BBR_RS19495 in Bifidobacterium breve UCC2003

Annotation: KR domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 8 to 194 (187 residues), 140.8 bits, E=6e-45
• PF08659: KR
  • amino acids 10 to 171 (162 residues), 55.2 bits, E=1.3e-18
• PF13561: adh_short_C2
  • amino acids 17 to 255 (239 residues), 166.7 bits, E=1e-52

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to bll:BLJ_1835)

Predicted SEED Role

"dehydrogenase clustered with L-fuconate utilization genes" in subsystem L-fucose utilization temp

MetaCyc Pathways

• gondoate biosynthesis (anaerobic) (3/4 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (22/31 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (6/9 steps found)
• fatty acid elongation -- saturated (3/5 steps found)
• oleate biosynthesis IV (anaerobic) (9/14 steps found)
• (5Z)-dodecenoate biosynthesis I (3/6 steps found)
• (5Z)-dodecenoate biosynthesis II (3/6 steps found)
• stearate biosynthesis IV (3/6 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (10/16 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (2/5 steps found)
• cis-vaccenate biosynthesis (2/5 steps found)
• superpathway of fatty acid biosynthesis II (plant) (29/43 steps found)
• 8-amino-7-oxononanoate biosynthesis I (6/11 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (6/12 steps found)
• superpathway of fatty acids biosynthesis (E. coli) (35/53 steps found)
• petroselinate biosynthesis (1/6 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (11/20 steps found)
• 2-allylmalonyl-CoA biosynthesis (1/8 steps found)
• biotin biosynthesis I (6/15 steps found)
• palmitate biosynthesis III (14/29 steps found)
• tetradecanoate biosynthesis (mitochondria) (11/25 steps found)
• streptorubin B biosynthesis (14/34 steps found)
• anteiso-branched-chain fatty acid biosynthesis (13/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (13/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (13/34 steps found)
• mycolate biosynthesis (17/205 steps found)
• superpathway of mycolate biosynthesis (18/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Protein Sequence (263 amino acids)

>BBR_RS19495 KR domain-containing protein (Bifidobacterium breve UCC2003)
MDLHLEGKVIIITGGFKGIGKGITLQLAQEGAIPVVINRPDSALDEFKKDIEQYTTTYDV
HLLDLNDTDKIAGVVEATYKKYGHIDGIVNNAGKNDNKDLETTTWREFEESLHGNLTHYY
ELVHAAVPYLKESRGSIVNISSKTALTGQGKTSAYAAAKGAILGLTREWAAALVHDSVRV
NAIVVSECWTPLYADWIKTFGDEAAQQARLSVITDKIPLEHRMTTTEEIGNEAAFLLSDR
SSHTTGQWVYVDGGYVHLDRALS