Protein Info for BBR_RS19490 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 270 to 295 (26 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 353 (333 residues), 91.3 bits, see alignment E=3.1e-30

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 100% identity to bll:BLJ_1834)

Predicted SEED Role

"transporter, major facilitator family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>BBR_RS19490 MFS transporter (Bifidobacterium breve UCC2003)
MTSKNTTGSKATIAIVLVTSLFFIWGLTMNLVNALNSPFANYIELSSAEASLLQVAYYGA
YFVMAIPAGLIAKRFGYKGGVISGLLLFALGAFMVIPATSMASYGLFLFAMFVIALGAAS
LETNCNPYITKLGDEKGESFRINMAQSFNGVGNIVGPLILGQILGTTVASGESGFDAAKT
QFLNDTRTIYIVIGVVLVVVLAVFALFKLPTPPGDEEEAAGGASSKNSSFFGLLKRPHFA
LGVLAEFIFIGLQVAGMAVFSAYALKHWGAGITAGTAAMMLSVLSLLFTIGRFVTTPLMA
KFDPAKILGVYMTISAVLMFVVFLGLGKVSVIAFMVAYLFISIGYPTIFSLTLKGIKGSA
AKTGSSALVMSIVGAALIPLLLGVIQDAAGIEIAILVMVPGFLFVAWYAFWGSKIGLKEA