Protein Info for BBR_RS19475 in Bifidobacterium breve UCC2003

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details PF03547: Mem_trans" amino acids 16 to 307 (292 residues), 86 bits, see alignment E=1e-28

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 98% identity to bll:BLJ_1830)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>BBR_RS19475 AEC family transporter (Bifidobacterium breve UCC2003)
MPGLISAMQGFCVIGIVIAVGYVAARMRIGGPSAQMVLNRFSFFVSSPCLMFAILSKEPI
FDIFHPSIIVAFFSAVLVGVAFLVLNQMFFHLNAPDATIGALNSLYLNSNNIGLPIATYI
LGNPALVAPILVMQQAIFTPVGLTVLDVTTKGKVSVKEIAKQPLHQPLLIGSLLGIVVSA
ISAKIGWFPVPKFIFDPIDMIGDSAVPMILMAFGMSLHGTKPLQQKGDRPAVFTVAVLKN
VIMPIIAFLLAYFVMGFRGSELYACVVLAALPTGQNVYNYAARYNVGLTFARDGILMSTM
TSPVFIAIIAALLS