Protein Info for BBR_RS19470 in Bifidobacterium breve UCC2003

Annotation: succinyl-diaminopimelate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 TIGR01900: succinyl-diaminopimelate desuccinylase" amino acids 12 to 400 (389 residues), 523.4 bits, see alignment E=1.2e-161 PF04389: Peptidase_M28" amino acids 58 to 156 (99 residues), 21.3 bits, see alignment E=2.9e-08 PF01546: Peptidase_M20" amino acids 71 to 399 (329 residues), 79.1 bits, see alignment E=7e-26 PF07687: M20_dimer" amino acids 195 to 288 (94 residues), 64.1 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 93% identity to bln:Blon_2303)

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>BBR_RS19470 succinyl-diaminopimelate desuccinylase (Bifidobacterium breve UCC2003)
MTLELNRNDSTAEQLNSLLIQIMENFSVSDHEGPLADEVEAFLNEQKHLTVRRHGDTVVA
STDFGKSNRVILAGHLDTVPVIDNFPPKWLEPGDPLIREEISQSHPTDRVLWGRGATDMK
ASDAVMLYLAATLDGLTSGTTPKVDLTYVFYDHEEVAAEKNGLRKVVETHPDWIAGDFAI
IGEPTNSGIEGGCNGTIRFDVVTHGVAAHSARAWMGENAIHKAADILNRLNAYETATVNV
DGLDYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDKNLAEAKALMMGADAGAELGNG
EHVATGGVFEGYGIEMKDESPSARPGLSAPLAQELVRLVKERTGRDPLAKLGWTDVARFS
QLGIPAVNLGAGDPLLAHKHDEQVPESDLTAMAAILEDWLV