Protein Info for BBR_RS19455 in Bifidobacterium breve UCC2003

Annotation: 50S ribosomal protein L27

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00062: ribosomal protein bL27
  • amino acids 1 to 80 (80 residues), 119.6 bits, E=2.3e-39
• PF01016: Ribosomal_L27
  • amino acids 2 to 80 (79 residues), 130.3 bits, E=1.1e-42

Best Hits

Swiss-Prot: 95% identical to RL27_BIFLD: 50S ribosomal protein L27 (rpmA) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K02899, large subunit ribosomal protein L27 (inferred from 91% identity to blt:Balat_0303)

MetaCyc: 66% identical to 50S ribosomal subunit protein L27 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L27p" in subsystem Ribosome LSU bacterial

Protein Sequence (83 amino acids)

>BBR_RS19455 50S ribosomal protein L27 (Bifidobacterium breve UCC2003)
MAHKKGASSSRNGRDSSPQYLGVKKFGGEAVVAGNIIVRQRGTNFHAGQNVGMGKDHTLF
ALADGSVKFGVRRDRKVVDVIAA