Protein Info for BBR_RS19450 in Bifidobacterium breve UCC2003

Annotation: GTPase ObgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 TIGR02729: Obg family GTPase CgtA" amino acids 4 to 348 (345 residues), 395.4 bits, see alignment E=1.8e-122 PF01018: GTP1_OBG" amino acids 5 to 166 (162 residues), 161.7 bits, see alignment E=2.2e-51 PF02421: FeoB_N" amino acids 170 to 341 (172 residues), 36.6 bits, see alignment E=6.5e-13 PF01926: MMR_HSR1" amino acids 170 to 278 (109 residues), 77.8 bits, see alignment E=1.4e-25 PF09269: DUF1967" amino acids 391 to 467 (77 residues), 78.9 bits, see alignment E=4.8e-26 TIGR03595: Obg family GTPase CgtA, C-terminal extension" amino acids 391 to 468 (78 residues), 87.4 bits, see alignment E=4.4e-29

Best Hits

Swiss-Prot: 95% identical to OBG_BIFLO: GTPase Obg (obg) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03979, GTP-binding protein (inferred from 94% identity to blj:BLD_1618)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>BBR_RS19450 GTPase ObgE (Bifidobacterium breve UCC2003)
MSDFVDRVTVHVRGGDGGNGSAGIRREKYKPLAGPNGGNGGDGGSVVFVADRNATSLLDY
RFMPHRTAGNGTMGLGDNKDGSKGEDLILPVPCGTVVFEARGEQGKTKHPGEQLADLRHE
GDRVVVAQGGAGGLGNIALANKTRRAPGFALLGELGEERDVILELKSIADVALVGFPSAG
KSSLIAAMSAAKPKIADYPFTTLVPNLGVVIAGDSRYTIADVPGLIPGASEGKGLGLEFL
RHIERTEIIAHVIDCATLEPDRDPMSDYQALENELALYADKLELPLGAIPIPERPRIVIL
NKIDVPEAKELAEFVRPEFEKLGLKVFEISTASHEGLKELNFALAELVHEMREEVASREE
VEEEARVVIKPLERTGRRPRRADEGGNALDFTVERRELGNGEVFYEVRGAKPERWVMQTN
FDNDEAVGYLADRLAKLGVEDELRRKGARPGDEIRIGRGDRMVEFDWDPSISAGAEMLDG
SNLGARGKDLRLEEQDPRAHRRSNAERRAQYHEMMDARAAVRDAMMAERKAGHWADPTVD
DDRHDETSLFGHGESADDSASEE