Protein Info for BBR_RS19420 in Bifidobacterium breve UCC2003

Annotation: transcription termination/antitermination factor NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02357: NusG
  • amino acids 90 to 192 (103 residues), 86.9 bits, E=1.1e-28
• TIGR00922: transcription termination/antitermination factor NusG
  • amino acids 91 to 273 (183 residues), 167 bits, E=1.7e-53
• PF00467: KOW
  • amino acids 223 to 253 (31 residues), 22.4 bits, 8.3e-09

Best Hits

Swiss-Prot: 45% identical to NUSG_STRVG: Transcription termination/antitermination protein NusG (nusG) from Streptomyces virginiae

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 84% identity to blj:BLD_1622)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Protein Sequence (275 amino acids)

>BBR_RS19420 transcription termination/antitermination factor NusG (Bifidobacterium breve UCC2003)
MSDELNLENLDAALENVDAAADEAPVADAPAEAVESAEPVAEAPVASPETATESAEEESE
VNESEQAEETDAGQKAVDEFSKSLRTLDGKWYVLHTYSGYEKRVKTNIESRVASFGMEDQ
IFQVEVPMEEVEKHTEKGKKVITRVRVPGYVLIRMWPDENARRVVRETEGVTGFVGPSKD
PAPLSRQEVVAMMAPMIASEALKAAGDKPAAAKKRKVEVSYAVGDQVTVTDGPFATMAAV
VSDVEPTTQKLTVLVSIFGRDTPVELGFHQVQKLD