Protein Info for BBR_RS19385 in Bifidobacterium breve UCC2003

Annotation: biotin biosynthesis protein BioY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 166 to 193 (28 residues), see Phobius details PF02632: BioY" amino acids 48 to 195 (148 residues), 106.5 bits, see alignment E=5.7e-35

Best Hits

KEGG orthology group: K03523, putative biotin biosynthesis protein BioY (inferred from 90% identity to blo:BL1534)

Predicted SEED Role

"Substrate-specific component BioY of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>BBR_RS19385 biotin biosynthesis protein BioY (Bifidobacterium breve UCC2003)
MQTSHTTSSTAATASLGRRIVAASWKPALFAVLMWLSAAAGAIPIPGTPVPITLQTFVVM
LAGLMLPWRQAGSAVAAYLAAGAVGLPVFAGGASTMALVGPSAGFLFGFLPGVIVIALLR
GKANTSSASAAALTAGRYLLAALVGGVVVVYAFGFVIQSALTGAPIAAVALASMGFVAGD
TIKAVVASLAAAGLSKLGR