Protein Info for BBR_RS19290 in Bifidobacterium breve UCC2003

Annotation: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF03602: Cons_hypoth95" amino acids 1 to 185 (185 residues), 148.8 bits, see alignment E=2.1e-47 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 2 to 187 (186 residues), 134.5 bits, see alignment E=1.8e-43 PF05175: MTS" amino acids 25 to 144 (120 residues), 24.4 bits, see alignment E=3e-09

Best Hits

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 90% identity to blf:BLIF_0264)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>BBR_RS19290 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (Bifidobacterium breve UCC2003)
MRVISGRFKGAALATPKTGTRPTTDRTKEAIFSHLDSWGVLDDARVLDLFAGTGALGIEA
LSRGARELVAVESSRPAAALIAKTFAQLQKNRSWDASLKARVLTKKAEQVTGGFGEPFDV
IFIDPPYAYGTDECNQLLADLAAGSATNTNTVIMLERSVRSEDPQAPEGWKITESRNYGE
TAVFYIEAIEPEA