Protein Info for BBR_RS19285 in Bifidobacterium breve UCC2003

Annotation: tRNA (guanosine(37)-N1)-methyltransferase TrmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF01746: tRNA_m1G_MT" amino acids 21 to 73 (53 residues), 45.9 bits, see alignment 2.8e-16 amino acids 133 to 281 (149 residues), 112 bits, see alignment E=1.6e-36

Best Hits

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>BBR_RS19285 tRNA (guanosine(37)-N1)-methyltransferase TrmD (Bifidobacterium breve UCC2003)
MKIDIVSVFPEYFEVMNLSLMGKAQAKGLLEIKAHNLRDWTHDVHHSVDDTPVGGGAGMV
MKPEVWGECLDELLGLSQQSDSVPAPGIAADSDADTNQSDDPVSAANTQSASVNVPVSSD
GSPAESDVSAQLSAPVLIFPNPSAPLFTQRDATELSHAKHLLFGCGRYEGYDARIPDYYR
SQGVDVREYSIGDYVLNGGEVAVSVMLEAITRLMPGFMGNPDSIVEESYTGEGALLEHHQ
YTKPAVWRDIAVPNVLLSGDHGKVDRYRRDEALARTAEIRPDLIAALDCKALDKADRKTL
MALGWEVSAAHPRKLE