Protein Info for BBR_RS19280 in Bifidobacterium breve UCC2003

Annotation: peptidase U32

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 PF01136: Peptidase_U32" amino acids 80 to 283 (204 residues), 289 bits, see alignment E=2.2e-90 PF16325: Peptidase_U32_C" amino acids 416 to 501 (86 residues), 54.2 bits, see alignment E=1.3e-18

Best Hits

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 75% identity to bla:BLA_0315)

Predicted SEED Role

"peptidase, U32 family large subunit [C1]"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>BBR_RS19280 peptidase U32 (Bifidobacterium breve UCC2003)
MRIPTRKKPEVLSPAGNLRGLKTAVDYGADAVYCGGKAFGMRSAPKNLSLEDFEEGSRYA
HERGARVYVTCNVLPRNNEIEAMREYIGQLKDTGVDALIVSDIGVMMMARQVAPNLELHV
STQAGVTNYQAANAFYELGARRVVLAREMDLQAVRDIRANIPDDLDIECFVHGAMCMAFS
GRCLFSNYLTGRDGNHGECAQPCRWKYSIVEEKRPGQYFPIEQTENGAYLFNSQDMNMLG
HLDDLIDSGATSLKIEGRAKSAYYIAAMTNAYKTAVNEYMIQRGFEDADGNILLPFHDRV
IRPSDPDYGQGTEDQVMRNADAAFAGVADEGYNTSDAPEPDGMSSHARSTRRKSNTAIEQ
IETDWKHAAVRPAPHVELPEWLLEETDKVAHRDYSTGFYYPEHKVTQNTDRSAYFRSWLV
VGEVLSWSADEGGRVTLMSRNKIEPGQQVEFLLPGERPLAYIVPEDGLRDADGTPVPAIN
NPAHVFSMPCPHQVPINAAIRSRTKKPTLKAE