Protein Info for BBR_RS19270 in Bifidobacterium breve UCC2003

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01128: IspD
  • amino acids 22 to 253 (232 residues), 157.5 bits, E=6.8e-50
• PF12804: NTP_transf_3
  • amino acids 24 to 157 (134 residues), 46.9 bits, E=5.1e-16
• PF00483: NTP_transferase
  • amino acids 24 to 110 (87 residues), 26 bits, E=1e-09

Best Hits

Swiss-Prot: 87% identical to ISPD_BIFLD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 87% identity to blm:BLLJ_0288)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Protein Sequence (281 amino acids)

>BBR_RS19270 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Bifidobacterium breve UCC2003)
MTERDSDIPETAAARPAQTAPVVAVVLAAGFGTRFDPDNPKQLVSVGGKPIVCWSIEAFE
RCGRVSDIVVVVNPKVRSAVESLIDDMGYTKVRVIIDGGAERVDSTAAALDTLAAAGIPD
DAKILIHDAVRPFVEQSSIEGSIDALDQFTAATVAYASTDTVLLTEDLGDVKVVKSVPDR
PNTFRAQTPQSFRFATIRRAYELAASDPDFHPTDDTRVVVDYLPDEPVAIVSGSETNLKI
TTLEDVPTAEHIAEEIQGRDPKEEARARMHALLAQAAGQMR