Protein Info for BBR_RS19245 in Bifidobacterium breve UCC2003

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 39 to 57 (19 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details PF01914: MarC" amino acids 2 to 190 (189 residues), 153.3 bits, see alignment E=3.1e-49 TIGR00427: membrane protein, MarC family" amino acids 3 to 188 (186 residues), 128 bits, see alignment E=1.9e-41

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 97% identity to blf:BLIF_0273)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>BBR_RS19245 membrane protein (Bifidobacterium breve UCC2003)
MALLALFPIINPVGAVASFATLTADLSKKELRCQARYTSLYVFAILAAFTILGSFILDMF
RLELPAIQIAGGFVVAHSGYRMLVPTSDHGDPEAHQDNDIAFTPMALPLIAGPGAIGEVI
GLSARYTEPRERLAILIAVLVISIVIMALLRWCTPLVHKLGPDGILGLTRIMGFIILCIG
VELMIHGVSTLAIGL