Protein Info for BBR_RS19230 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 283 (197 residues), 55.3 bits, see alignment E=3.6e-19

Best Hits

Swiss-Prot: 43% identical to YESP_BACSU: Probable ABC transporter permease protein YesP (yesP) from Bacillus subtilis (strain 168)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to blf:BLIF_0276)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 1" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>BBR_RS19230 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MKVLAKVNKRAWPYLFILPWIIGFLVFTLGPLVLSFVMSFFDWSITGTPKFRGLGNYIEM
FTTDDQALKSLSISLKYAAIFVPLNMIIALVLAMLISQPVKGAKFFRTIFYIPAVISGVA
VSIIFGWLLNGNYGVINYLLSLLGIDGPQWLVDPKWAIIAVIFASAFGVGSMMLIFYTDI
KNIPIDLYEAAAIDGAGPARQFFSITLPMITPTILFNLITSIISSFQQVTLVMLLTNGGP
MKSTYFYGLMTYNNAFKFHKLGYASANAWVMFIIILLLSALVFKSSDTWVFYESTANKNK
AKKGKKAKGKEVAR