Protein Info for BBR_RS19215 in Bifidobacterium breve UCC2003

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details PF00892: EamA" amino acids 6 to 135 (130 residues), 72.9 bits, see alignment E=1.5e-24 amino acids 144 to 278 (135 residues), 70.6 bits, see alignment E=7.7e-24

Best Hits

KEGG orthology group: None (inferred from 97% identity to blf:BLIF_0279)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>BBR_RS19215 EamA/RhaT family transporter (Bifidobacterium breve UCC2003)
MKRGMAIAGLIVVTAIWGGGFVASDIALNSLTPMQIMAIRFLLGAVLMSLISVREFRNIN
IKEIGAGVLMGIALFAAFALQIIGLQYTTPSKNAFLTALNVVMVPFIAFLVLRKRIGWRG
VLGACLSVVGVAVLSLNGNMTLGLGDALSLLCAVGFAFQIFFTGLFVQRYRATILNCVQM
VTAFVLSVVVMVAMGQVHLTPTTDGWWSVLYLGAVSTTICYLLQTACQQYVDETKAAIIL
SMESVFGTLFSILLLGEVVTPRMIVGCAIILVAVVISNLAASSEDEQPADTPVPEPSGEV
SG