Protein Info for BBR_RS19210 in Bifidobacterium breve UCC2003

Annotation: beta-phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR02009: beta-phosphoglucomutase family hydrolase" amino acids 3 to 185 (183 residues), 189.6 bits, see alignment E=1.3e-59 PF00702: Hydrolase" amino acids 3 to 182 (180 residues), 84.4 bits, see alignment E=1.4e-27 TIGR01990: beta-phosphoglucomutase" amino acids 4 to 187 (184 residues), 227.8 bits, see alignment E=2.1e-71 PF13419: HAD_2" amino acids 6 to 187 (182 residues), 87.5 bits, see alignment E=1.2e-28 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 90 to 184 (95 residues), 49.9 bits, see alignment E=7.9e-17

Best Hits

Swiss-Prot: 40% identical to PGMB_BACSU: Beta-phosphoglucomutase (yvdM) from Bacillus subtilis (strain 168)

KEGG orthology group: K01838, beta-phosphoglucomutase [EC: 5.4.2.6] (inferred from 97% identity to blf:BLIF_0280)

MetaCyc: 39% identical to beta-phosphoglucomutase (Lactococcus lactis)
Beta-phosphoglucomutase. [EC: 5.4.2.6]

Predicted SEED Role

"Beta-phosphoglucomutase (EC 5.4.2.6)" in subsystem Maltose and Maltodextrin Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization or Trehalose Uptake and Utilization (EC 5.4.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>BBR_RS19210 beta-phosphoglucomutase (Bifidobacterium breve UCC2003)
MRYQAIIFDLDGVICRTDQYHYLAWKQVADELGIPFDEQVNERLRGVSRMASFDIILERS
NVTMSDEEKIHWTDKKNKIYKSMLTQMGPDDMLEGVADTLHKLRAMELDLAIGSSSRNTK
FILGQLGLSDFFDAISDGTNITHSKPDPEVFVKATEFLNRAPAECLVVEDAEAGLQAATA
GGMDSAAFGEIAIRSGLGTWNLERFSDLIGIVA