Protein Info for BBR_RS19190 in Bifidobacterium breve UCC2003

Annotation: 3-deoxy-7-phosphoheptulonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR00034: 3-deoxy-7-phosphoheptulonate synthase" amino acids 61 to 408 (348 residues), 468.8 bits, see alignment E=4e-145 PF00793: DAHP_synth_1" amino acids 98 to 396 (299 residues), 280.2 bits, see alignment E=6.5e-88

Best Hits

Swiss-Prot: 52% identical to AROG_ECOLI: Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive (aroG) from Escherichia coli (strain K12)

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 94% identity to blb:BBMN68_1082)

MetaCyc: 52% identical to 3-deoxy-7-phosphoheptulonate synthase, Phe-sensitive (Escherichia coli K-12 substr. MG1655)
3-deoxy-7-phosphoheptulonate synthase. [EC: 2.5.1.54]

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I alpha (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>BBR_RS19190 3-deoxy-7-phosphoheptulonate synthase (Bifidobacterium breve UCC2003)
MQQQDGSATATHPLQVGPQPLNTPEELRAIRQAMGEGKNPLIATDVPRWEDQVGVSRIIN
RRVLELEPLPTPAQVLAELPLTDKAQEIVAYSRDEIRACLYGQDDRLLVIVGPCSVHDPQ
AALDYAHRLAALKDELGEQLLIVMRVYFEKPRTTVGWKGLINDPDIDGSHNIKKGLLLAR
KTLLGVLDEGLAAATEFLEPTSPQFISDAVSWGAIGARNTESQIHRQLASGLSMPVGFKN
ATDGSVKAAVNGCFAAAQQHTFFGIDHLGRACAVETLGNPDCHVVLRGSAYGPNYDAESV
AKAMGDVRAEMPAESAASHGLIIDCSHGNSGKDEHRQAEVVRNIAGRIAAGEQGITGVMM
ESFIEGGNQKAAPLDQLVYGKSITDKCISWPDAEALLRELAEAVATRRWH