Protein Info for BBR_RS19185 in Bifidobacterium breve UCC2003

Annotation: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01048: PNP_UDP_1
  • amino acids 5 to 234 (230 residues), 145.6 bits, E=8e-47
• TIGR01704: MTA/SAH nucleosidase
  • amino acids 6 to 237 (232 residues), 124.3 bits, E=2.8e-40

Best Hits

Swiss-Prot: 33% identical to MTNN_SERP5: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (mtnN) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01243, S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [EC: 3.2.2.9] (inferred from 95% identity to blm:BLLJ_0294)

Predicted SEED Role

No annotation

MetaCyc Pathways

• S-adenosyl-L-methionine salvage I (4/4 steps found)
• autoinducer AI-2 biosynthesis II (Vibrio) (5/6 steps found)
• autoinducer AI-2 biosynthesis I (4/5 steps found)
• S-methyl-5'-thioadenosine degradation IV (1/1 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (5/7 steps found)
• S-methyl-5'-thioadenosine degradation I (1/2 steps found)
• 5'-deoxyadenosine degradation II (1/4 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (2/12 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.9

Protein Sequence (237 amino acids)

>BBR_RS19185 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (Bifidobacterium breve UCC2003)
MGMKTVAIIGALDEEVALIAKSLTHVTHTAKGSLDIVSGTVDSFGSDVIKVAATVGGMGL
VNAAATTQLLIDEFAPDAVIFTGIAGNLNTHLHINDVVLGGTLRYLDTDMRLVGQWKPGT
ADAPVEEFHSDDHLLEVADAALAEAGITHIVGIIASGNYFVDTPEKVEEVVRLTGADAVE
MEGAAVAQVAARNDVPALVVRALSDNADTDYEVFKEFDISEYADTAARLAVDIVKRL