Protein Info for BBR_RS19180 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 59 to 83 (25 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 147 (26 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 24 to 235 (212 residues), 83.9 bits, see alignment E=1.2e-27 amino acids 275 to 432 (158 residues), 37.6 bits, see alignment E=1.3e-13 PF07690: MFS_1" amino acids 41 to 377 (337 residues), 110.8 bits, see alignment E=7.3e-36 amino acids 277 to 428 (152 residues), 45.4 bits, see alignment E=5.4e-16

Best Hits

Swiss-Prot: 49% identical to YHJE_ECOLI: Inner membrane metabolite transport protein YhjE (yhjE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to bll:BLJ_0342)

Predicted SEED Role

"transmembrane transport protein possibly for shikimate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>BBR_RS19180 MFS transporter (Bifidobacterium breve UCC2003)
MPASTTAAVTEPVKKDSVPEIIAASMVGTAIEFYDNYCYSIAAASYFGAIFFANVTNPAL
AQIMAFTTFAVSFLARPFGSMLFGHFGDKMGRKKTLVIALLTMGIATFLVGCLPGYEQVG
GVSVVILCVCRACQGVGLAGEWSGAALVATENAPASKRALYGSFPNLGAPIGFFCAYGLN
LLLTTHLGQEQMGAWGWRIPFLASVVLVIIGLYVRARMSETPVFQKASEEKRTSKHPLRD
LLPYWKEVVLGTVAMGITYTLFYVLGTWSLSYGVKGLGFQQSEYLLLQMVSVVFFAIFIV
VSCVYADKVGRKKVLLAVTAATLVFSFFTPFLLVHSAAHILVFLCIGFVLMGGLFGPCGA
YLPELFPVHVRYSGAGLSYNLAAIFGGAFAPTIAQALVNSKFGVAGVGWYMAIMAALALL
ALFLIKESKDKDYEL