Protein Info for BBR_RS19175 in Bifidobacterium breve UCC2003

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details PF00512: HisKA" amino acids 180 to 244 (65 residues), 42.3 bits, see alignment E=9.2e-15 PF02518: HATPase_c" amino acids 309 to 419 (111 residues), 99.8 bits, see alignment E=2e-32

Best Hits

KEGG orthology group: K07768, two-component system, OmpR family, sensor histidine kinase SenX3 [EC: 2.7.13.3] (inferred from 82% identity to bll:BLJ_0343)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>BBR_RS19175 two-component sensor histidine kinase (Bifidobacterium breve UCC2003)
MDIWQIIVFVVLAALVVAWVAIIAYNKGRVSGRVSAQQAAASDETALCLFGDDVPVRPTE
RRLVEVLPEALIVTDRNGRVQYASPGSVPFGLVSGNRLNSREVEDILTQAATDGGVRERE
VQMPVNRSAFPSSNGRGLEAGQSMPSNMLYLRVRIGDIGDDLYAIFINDMSEQRRFEAVR
RDFVTNVSHELKTPTGAISLLAETVTDAADDPDAVRYFSGRISKESARLTELVRRLIDLQ
KAQSSEGSVIDVKRISALAVARAAINDNQVQADARYIDIRLNVNGKPVPISAGEGDDEPS
ETELMIMADADAMQTAVKNLVENAIHYSPEHTTVAVGVGERDGKVTIRVVDQGIGIPEKS
LDRVFERFYRVDPARSRETGGSGLGLAITKHCVQENGGRISVWSRKGEGSTFTIELPAAP
ADEEPTAVQGA