Protein Info for BBR_RS19165 in Bifidobacterium breve UCC2003

Annotation: phosphate ABC transporter substrate-binding protein PstS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF12849: PBP_like_2" amino acids 41 to 344 (304 residues), 155.8 bits, see alignment E=1.9e-49 TIGR00975: phosphate ABC transporter, phosphate-binding protein PstS" amino acids 52 to 373 (322 residues), 213.7 bits, see alignment E=1.7e-67 PF01547: SBP_bac_1" amino acids 57 to 347 (291 residues), 36.3 bits, see alignment E=6.7e-13

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 92% identity to blm:BLLJ_0297)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>BBR_RS19165 phosphate ABC transporter substrate-binding protein PstS (Bifidobacterium breve UCC2003)
MQKNILIRSIAALSGIVMLASVAACGDNTASTTDSSSTDSASKTAPISGNFQGAGASSQQ
SAVEAWIAGFQGANPDAKIAYNPSGSGAGVQTFLTGATAWAGSDKALADDEVEQSKSVCA
DGTAFDVPVYVSPIAVIFNLKGVSDAGKHINMDADTIAKIFDGKITKWNDPAIADQNKDL
TLPDTAITVVHRSDKSGTTQNFVSYFKDQAPDSWTYDLSENWPNEVGQGAKGTSGVVSTV
KQADGTIGYADFSQVGDLGTVAVKVGDSYNEISAEAGSKVIEDSKQDDTVKGDNRIVIKI
NHATEAKGAYPIVLVSYDIVCPAYKDTKQAEFAKAWLTYVTSDEGQKAAQDAAGTAPLPS
SLKSEITKSIKAIKTK