Protein Info for BBR_RS19160 in Bifidobacterium breve UCC2003

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 77 to 106 (30 residues), see Phobius details amino acids 118 to 146 (29 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 229 to 252 (24 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 18 to 315 (298 residues), 315.7 bits, see alignment E=1.3e-98 PF00528: BPD_transp_1" amino acids 100 to 311 (212 residues), 57.5 bits, see alignment E=7.9e-20

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 97% identity to bln:Blon_0364)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>BBR_RS19160 phosphate ABC transporter permease subunit PstC (Bifidobacterium breve UCC2003)
MSSQDKTAVQPVGGKTADKVFRGVAYACGILILVVLAAVFLFLFFRAWPLIGGDQVANSK
TVSSFTGGKANNFWGYVLPLLFGTVLVSVLALIIAFFVSIGIALFISHYAPKKLATALSY
VVDLLAAIPSVIYGLWGGLILVPAIYPFWNWVANHLGFIPLFAGPAANPSRTVATVAVVL
AVMILPIITSMSRDIFMQTPRLHEEAALALGATKWEMIRLAVLPFGKSGIVSASMLALGR
ALGETMAVLMILSPGLNYSIKLLQASQNQTIAANIAAQYPEANELGVSTLIGTGLILFLI
TFVVNFIARKITEKATA