Protein Info for BBR_RS19155 in Bifidobacterium breve UCC2003

Annotation: phosphate ABC transporter, permease protein PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 38 to 63 (26 residues), see Phobius details amino acids 99 to 126 (28 residues), see Phobius details amino acids 138 to 164 (27 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 39 to 327 (289 residues), 317.2 bits, see alignment E=3.8e-99 PF00528: BPD_transp_1" amino acids 115 to 327 (213 residues), 76.6 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 92% identity to bln:Blon_0365)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>BBR_RS19155 phosphate ABC transporter, permease protein PstA (Bifidobacterium breve UCC2003)
MTAAENTEKTPMDGAPKIDFDRFRPTRSSVQRRKSMDIFMWVLIALAFIIACVPLVSLLW
TTIVNGIKRLNLNFLTYNMTGVVGGSQTPSGGYGGVLHAIIGTLEITAGAMVISIPIGLM
CAVYLVEYANRSKLATTISLLVDVMSGIPSIVAGLFAFSMFTILLGPGTINGFEGSVALS
LLMLPTVVKSSEEMLKIVPNDLREASLALGVTKQRTITKIVLRTALPGIVSGAILAIARV
IGETAPLLMTAGYIVNTNVNLFSGQMTTLPVFVYQEYSKLSANCPPNAASTCVTTIPMER
AWAAALVLIIVVLLLNLIGRIVAKVFAVKTDR