Protein Info for BBR_RS19150 in Bifidobacterium breve UCC2003

Annotation: phosphate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 5 to 259 (255 residues), 354.1 bits, see alignment E=1.8e-110 PF00005: ABC_tran" amino acids 21 to 177 (157 residues), 112.4 bits, see alignment E=2.7e-36

Best Hits

Swiss-Prot: 99% identical to PSTB_BIFLO: Phosphate import ATP-binding protein PstB (pstB) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 98% identity to blb:BBMN68_1075)

MetaCyc: 55% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>BBR_RS19150 phosphate ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MGQRIDVNHENIYYGDFLAVEDVNINIEPNKVTAFIGPSGCGKSTVLRTLDRMHEIIPGA
HVEGEVLLEGKNLYDKDVDPVAVRRDVGMVFQRPNPFPTMSIRENVLAGVRLNNHHMAKS
DADDLVEWALRGANLWEEVKDRLDNPGIGLSGGQQQRLCIARAVAVHPQVLLMDEPCSAL
DPISTLAVEDLINELKSDYTIVIVTHNMQQAARIADYTAFFNLKAVGQPGHLEYFADTTT
MFNNPQNEEAERYISGRFG