Protein Info for BBR_RS19130 in Bifidobacterium breve UCC2003

Annotation: 50S ribosomal protein L7/L12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00855: ribosomal protein bL12
  • amino acids 1 to 126 (126 residues), 151.9 bits, E=5.5e-49
• PF16320: Ribosomal_L12_N
  • amino acids 5 to 53 (49 residues), 64.9 bits, E=4.3e-22
• PF00542: Ribosomal_L12
  • amino acids 60 to 126 (67 residues), 101.3 bits, E=2.9e-33

Best Hits

Swiss-Prot: 93% identical to RL7_BIFLO: 50S ribosomal protein L7/L12 (rplL) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 97% identity to bde:BDP_0395)

MetaCyc: 52% identical to 50S ribosomal subunit protein L12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial

Protein Sequence (126 amino acids)

>BBR_RS19130 50S ribosomal protein L7/L12 (Bifidobacterium breve UCC2003)
MAKYTNDELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPAAVAVAAPGAAAPAAEEKDEF
DVILSAVGDKKIQVIKAVRAITNLGLAEAKGLVDGAPKAVLEKAKKEDAEKAKAQLEEAG
ATVELK