Protein Info for BBR_RS19100 in Bifidobacterium breve UCC2003

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 35 to 178 (144 residues), 62 bits, E=1e-20
• PF00583: Acetyltransf_1
  • amino acids 69 to 177 (109 residues), 27.2 bits, E=4.2e-10

Best Hits

KEGG orthology group: K03790, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 89% identity to blf:BLIF_1774)

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128

Protein Sequence (221 amino acids)

>BBR_RS19100 N-acetyltransferase (Bifidobacterium breve UCC2003)
MATIKAVSVFQSIKEAFKPDHQIRMPRLSHPAFPITLRPLTLDDEEEWNEVRWRNNDWLA
PWESGDPMHGGFITFNQWIQRQRRNEQHGVGALFAIEYQMRIVGQISLGAISYGSMRTGV
VGYWVDQCYAGHGFAPMAVALLADWALTDPFGPVLHRLEIAILPDNARSLAVVRKVGAHH
EGLRERYMYVNGQWRDHVTFALLAEDAGQGFANRLASQNLQ