Protein Info for BBR_RS19055 in Bifidobacterium breve UCC2003

Annotation: ferredoxin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF00037: Fer4" amino acids 34 to 55 (22 residues), 34.5 bits, see alignment 1.2e-12

Best Hits

Swiss-Prot: 68% identical to FER_SACER: Ferredoxin (fdxA) from Saccharopolyspora erythraea

KEGG orthology group: None (inferred from 97% identity to bbi:BBIF_1520)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>BBR_RS19055 ferredoxin family protein (Bifidobacterium breve UCC2003)
MPYVIAQPCVDVKDKACVDECPVDCIYEGSRSLYINPNECVDCGACEPVCPTEAIFYEDD
LPDEWAWYKDAAVSFFAEVGDLGGASANGPIGKDPEQVAALPPQNQ