Protein Info for BBR_RS19020 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 86 to 112 (27 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 172 to 196 (25 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 296 (193 residues), 53.8 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: K10189, lactose/L-arabinose transport system permease protein (inferred from 88% identity to bad:BAD_1289)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 1" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>BBR_RS19020 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MVKHAKAQEKGAGSSLRRRQTLLAWGFALPFAVIFCVFMLIPLISSMAMSFTDITSRDLR
TPFNVNFVGLDQYIALFSDKRFLHSLGVTGIFVLIGLPITMIIALAFAVALNKGSQHLNA
FFRALFYAPVVASVVAVSVVWRYILQGDGLLNSLLSLVGVQGSDWLHETRYALPALMIMT
VWRNMGTLMIIFLAGLQAIPEELKEAAAIDGASKWRTFRSITLPLMKPTLLLGAVLLSVG
YLQFFEESFVMTQGGPLDSTLSAAYYVYQKFGFGQYGIASAASWVLFIIIALVSVLQFRI
LRSED