Protein Info for BBR_RS19015 in Bifidobacterium breve UCC2003

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 111 to 289 (179 residues), 77.5 bits, see alignment E=5.6e-26

Best Hits

KEGG orthology group: K10190, lactose/L-arabinose transport system permease protein (inferred from 87% identity to bad:BAD_1288)

MetaCyc: 30% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 2" in subsystem Chitin and N-acetylglucosamine utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>BBR_RS19015 carbohydrate ABC transporter permease (Bifidobacterium breve UCC2003)
MSATIQSAGCPAPAQDNKLLLWQRFIKGRGISYIVLAVIGIVWIFPFLWMALGSLKTQRE
ILAKPPKLMPEHATLANFSQWFTQLNFGSYFTNSLIVAVITVLGNMVFCSMVGYALAKMK
FAGKNILFGAVMVTLMVPSVATFVPLFVIISNMHLANTYAALILPFLCQPIGVFLMRQFI
GGIPDALMEAARVDGAGELRIFFQIILPQCGPALATLSILTFLSSWNNFLWPLVSAQSEE
MYTLPVALSLYSTGQNATNYSVLLAGAVLVITPILLLFVFLQRYFIQGVAMTGIK