Protein Info for BBR_RS18955 in Bifidobacterium breve UCC2003

Annotation: bifunctional acetaldehyde-CoA/alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 59% identical to ADH2_ENTHI: Aldehyde-alcohol dehydrogenase 2 (ADH2) from Entamoeba histolytica

KEGG orthology group: K04072, acetaldehyde dehydrogenase / alcohol dehydrogenase [EC: 1.1.1.1 1.2.1.10] (inferred from 98% identity to bln:Blon_2241)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1); Acetaldehyde dehydrogenase (EC 1.2.1.10)" (EC 1.1.1.1, EC 1.2.1.10)

MetaCyc Pathways

heterolactic fermentation (16/18 steps found)
superpathway of N-acetylneuraminate degradation (17/22 steps found)
3-methylbutanol biosynthesis (engineered) (6/7 steps found)
pyruvate fermentation to ethanol I (3/3 steps found)
L-threonine degradation IV (2/2 steps found)
ethanol degradation I (2/2 steps found)
acetylene degradation (anaerobic) (4/5 steps found)
ethanolamine utilization (4/5 steps found)
pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
superpathway of anaerobic sucrose degradation (14/19 steps found)
acetaldehyde biosynthesis I (1/1 steps found)
phytol degradation (3/4 steps found)
superpathway of L-threonine metabolism (13/18 steps found)
2-deoxy-D-ribose degradation I (2/3 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-valine degradation II (2/3 steps found)
ethanol degradation II (2/3 steps found)
pyruvate fermentation to ethanol III (2/3 steps found)
pyruvate fermentation to ethanol II (1/2 steps found)
mixed acid fermentation (11/16 steps found)
(S)-propane-1,2-diol degradation (3/5 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
2-aminoethylphosphonate degradation I (1/3 steps found)
2-deoxy-α-D-ribose 1-phosphate degradation (1/3 steps found)
2-hydroxypenta-2,4-dienoate degradation (1/3 steps found)
L-methionine degradation III (1/3 steps found)
sulfoacetaldehyde degradation IV (1/3 steps found)
superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
salidroside biosynthesis (1/4 steps found)
serotonin degradation (3/7 steps found)
superpathway of pyrimidine deoxyribonucleosides degradation (2/6 steps found)
catechol degradation I (meta-cleavage pathway) (1/5 steps found)
phenylethanol biosynthesis (1/5 steps found)
butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
triethylamine degradation (1/6 steps found)
catechol degradation II (meta-cleavage pathway) (1/7 steps found)
superpathway of purine deoxyribonucleosides degradation (1/7 steps found)
toluene degradation I (aerobic) (via o-cresol) (1/7 steps found)
toluene degradation V (aerobic) (via toluene-cis-diol) (1/7 steps found)
3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (1/8 steps found)
p-cumate degradation (1/8 steps found)
noradrenaline and adrenaline degradation (4/13 steps found)
meta cleavage pathway of aromatic compounds (1/10 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (3/13 steps found)
p-cymene degradation (1/11 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (5/17 steps found)
L-tryptophan degradation IX (1/12 steps found)
L-tryptophan degradation XII (Geobacillus) (1/12 steps found)
naphthalene degradation to acetyl-CoA (1/12 steps found)
L-tryptophan degradation V (side chain pathway) (1/13 steps found)
toluene degradation IV (aerobic) (via catechol) (1/13 steps found)
mandelate degradation to acetyl-CoA (1/18 steps found)
superpathway of aerobic toluene degradation (1/30 steps found)
superpathway of aromatic compound degradation via 3-oxoadipate (2/35 steps found)
superpathway of aromatic compound degradation via 2-hydroxypentadienoate (3/42 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (909 amino acids)

>BBR_RS18955 bifunctional acetaldehyde-CoA/alcohol dehydrogenase (Bifidobacterium breve UCC2003)
MAEAKKKVEATKPTPEEKQAAAEAEVDALVTKALKALDEFEALDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGVIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKCSVEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMQHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDS
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYAPLIKELKLRKAYFVNAEEKAKLE
KYMFGCVAGSGEKPVLNSVVPGKSPQFIAKAAGFDIPEDATILAAECKEVSDDEPLTHEK
LAPVQAVLKADNKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKIIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAAMMRDEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTDA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYVAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQEEGHKLRIEREGE
AATEEASER