Protein Info for BBR_RS18920 in Bifidobacterium breve UCC2003

Annotation: 50S ribosomal protein L2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01171: ribosomal protein uL2
  • amino acids 3 to 269 (267 residues), 402.2 bits, E=5.8e-125
• PF00181: Ribosomal_L2
  • amino acids 42 to 118 (77 residues), 119 bits, E=7.1e-39
• PF03947: Ribosomal_L2_C
  • amino acids 126 to 248 (123 residues), 165.2 bits, E=7e-53

Best Hits

Swiss-Prot: 98% identical to RL2_BIFLO: 50S ribosomal protein L2 (rplB) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02886, large subunit ribosomal protein L2 (inferred from 98% identity to bll:BLJ_1749)

MetaCyc: 58% identical to 50S ribosomal subunit protein L2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L2p (L8e)" in subsystem Ribosome LSU bacterial

Protein Sequence (276 amino acids)

>BBR_RS18920 50S ribosomal protein L2 (Bifidobacterium breve UCC2003)
MAIRVYKPTSAGRRNASVSDFSDLTRSTPEKSLVRKNSKTGGRNSYGRITSRHRGGGHKR
QYRLIDFKRWDKDGVPAKVAEIEYDPNRSARIALLHFADGEKRYIIAPKGVKQGDVIETG
AQADIKPGNNLPLKNIPTGTVVHAIELRPLGGAKIARSAGAAVQLVAKDGAYAQLRMPSG
EIRNVDARCRATVGEVGNEDHANVQLGKAGRARWIGKRPVTRGESMNPVDHPHGGRTRGG
KPPVSPWGKGEVRTRRPKKASNKMIVRRRPSGKNRK