Protein Info for BBR_RS18910 in Bifidobacterium breve UCC2003

Annotation: 50S ribosomal protein L22

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 TIGR01044: ribosomal protein uL22" amino acids 5 to 112 (108 residues), 124.8 bits, see alignment E=7.8e-41 PF00237: Ribosomal_L22" amino acids 5 to 112 (108 residues), 124.3 bits, see alignment E=1.1e-40

Best Hits

Swiss-Prot: 97% identical to RL22_BIFLS: 50S ribosomal protein L22 (rplV) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K02890, large subunit ribosomal protein L22 (inferred from 97% identity to blf:BLIF_1745)

Predicted SEED Role

"LSU ribosomal protein L22p (L17e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>BBR_RS18910 50S ribosomal protein L22 (Bifidobacterium breve UCC2003)
MEAKAIARHVRVTPRKARRMVDLIRGKKATDAVTILKFAPQAAALPVRKTLESAIANARV
KADKAGEPFRENDLFIKETFVDEGVTLKRFRARAQGRAARINKRTSHITVVVATKEGAR