Protein Info for BBR_RS18900 in Bifidobacterium breve UCC2003

Annotation: 50S ribosomal protein L16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01164: ribosomal protein uL16
  • amino acids 2 to 127 (126 residues), 179.8 bits, E=1.1e-57
• PF00252: Ribosomal_L16
  • amino acids 4 to 132 (129 residues), 181.1 bits, E=4.6e-58

Best Hits

Swiss-Prot: 99% identical to RL16_BIFLS: 50S ribosomal protein L16 (rplP) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K02878, large subunit ribosomal protein L16 (inferred from 97% identity to blo:BL1586)

MetaCyc: 49% identical to 50S ribosomal subunit protein L16 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L16p (L10e)" in subsystem Ribosome LSU bacterial

Protein Sequence (139 amino acids)

>BBR_RS18900 50S ribosomal protein L16 (Bifidobacterium breve UCC2003)
MLIPKRTKYRKQHRPVRSGMSKGGNEINFGDFGIQALAPAYVTNRQIEAARIAMTRYIKR
GGRVWITIFPDRPLTKHPLGARMGSGKGAPEFWIANVRPGRVMFEIGGVSEDVAREALRR
AIDKLPMKCRIIAREGGDI