Protein Info for BBR_RS18865 in Bifidobacterium breve UCC2003

Annotation: 30S ribosomal protein S8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 96 to 112 (17 residues), see Phobius details PF00410: Ribosomal_S8" amino acids 5 to 132 (128 residues), 160.7 bits, see alignment E=8.5e-52

Best Hits

Swiss-Prot: 100% identical to RS8_BIFLS: 30S ribosomal protein S8 (rpsH) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K02994, small subunit ribosomal protein S8 (inferred from 93% identity to gva:HMPREF0424_0265)

MetaCyc: 50% identical to 30S ribosomal subunit protein S8 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S8p (S15Ae)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>BBR_RS18865 30S ribosomal protein S8 (Bifidobacterium breve UCC2003)
MTMTDPIADMLTRLRNASAAKHETVDMPYSKFKANIAEILKREGYIKDFTAKEAKVGQTL
EVTLKYGPNGERSIQGIKRISKPGLRRYAKSDSLPMPLGGLGIAIISTSSGLLTQKECLD
RGIGGEIVAFVW