Protein Info for BBR_RS18855 in Bifidobacterium breve UCC2003

Annotation: 50S ribosomal protein L18

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 PF00861: Ribosomal_L18p" amino acids 10 to 123 (114 residues), 160.6 bits, see alignment E=9.2e-52 TIGR00060: ribosomal protein uL18" amino acids 11 to 123 (113 residues), 129.9 bits, see alignment E=2.9e-42

Best Hits

Swiss-Prot: 95% identical to RL18_BIFLS: 50S ribosomal protein L18 (rplR) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K02881, large subunit ribosomal protein L18 (inferred from 95% identity to blm:BLLJ_1665)

Predicted SEED Role

"LSU ribosomal protein L18p (L5e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>BBR_RS18855 50S ribosomal protein L18 (Bifidobacterium breve UCC2003)
MSVAILGKGKKVALKRRHVRIRKRISGTAERPRLVVTRSNRHMVAQVVDDTKGVTLVSAS
TLQADFAGFKGTKTEAAKKVGELIADKAKAAGITEVVFDRGGNKYTGRVAAVADGAREGG
LAL