Protein Info for BBR_RS18850 in Bifidobacterium breve UCC2003

Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR01021: ribosomal protein uS5" amino acids 54 to 207 (154 residues), 208.4 bits, see alignment E=2.5e-66 PF00333: Ribosomal_S5" amino acids 56 to 119 (64 residues), 94.4 bits, see alignment E=3.4e-31 PF03719: Ribosomal_S5_C" amino acids 134 to 201 (68 residues), 102.2 bits, see alignment E=8.1e-34

Best Hits

Swiss-Prot: 98% identical to RS5_BIFLD: 30S ribosomal protein S5 (rpsE) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 97% identity to bll:BLJ_1735)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>BBR_RS18850 30S ribosomal protein S5 (Bifidobacterium breve UCC2003)
MSDNETKETQVAEETQNTVATESNNEDRKGRRGQRGEGRRGERRNRREENRGDELLDRVV
TINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQLDAKKHMFSVPR
VRGTITHPVQGHDAAGTVLLRPAAPGTGVIAGGSVRAVMECAGITDVLTKSMGSATAVNV
VRATVDALKQLEEPEEIAARRGLALNEVAPDALLRARAAGIDEARKAREEAAKKAAEEKD
GE