Protein Info for BBR_RS18835 in Bifidobacterium breve UCC2003

Annotation: preprotein translocase subunit SecY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 17 to 34 (18 residues), see Phobius details amino acids 72 to 97 (26 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details amino acids 402 to 420 (19 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 14 to 429 (416 residues), 403.5 bits, see alignment E=5e-125 PF00344: SecY" amino acids 74 to 420 (347 residues), 349.1 bits, see alignment E=1.2e-108

Best Hits

Swiss-Prot: 57% identical to SECY_STRCO: Protein translocase subunit SecY (secY) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K03076, preprotein translocase subunit SecY (inferred from 98% identity to bll:BLJ_1732)

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>BBR_RS18835 preprotein translocase subunit SecY (Bifidobacterium breve UCC2003)
MRTLIQALKTKELRKKILFVLFIIIVYRIGSFIPTPGVDYNVVNKCMATIGSASQENFIG
LVNLFSGGAMLQLSIFALGVMPYITASIVVQLLRVVIPRFEALHKEGQSGEAKLTQYTRY
LTIGLAVLQSTTILVTARSGALFNYKCDQVIPDGSVWNLVVMVLIMTGGTGLIMWMAELV
TDKGIGQGMSILIFMSICSGFLPQLWEIGYGTNGTDGDWLKFGIVVGVLVVILIFVDFVE
LCQRRVPVQYTRRMIGRKMYGGSSTYLPLKINMSGVIPPIFASSILAIPTLIAQFGKSDQ
SWVKWINNNLANTTSVWYIALYALMIVFFCFFYTSITFNPDETADNMKQYGGFIPGIRAG
NATSRYLTYVMNRLNTVGAVYLLFVALIPTVLIMALGLNAKLPFGGTTILIIAGVGLDTL
RQAKAQTEQFQYTGFLLENVDHKEG