Protein Info for BBR_RS18815 in Bifidobacterium breve UCC2003

Annotation: 30S ribosomal protein S13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03631: ribosomal protein uS13
  • amino acids 3 to 115 (113 residues), 172.3 bits, E=2e-55
• PF00416: Ribosomal_S13
  • amino acids 3 to 109 (107 residues), 111.6 bits, E=1.9e-36

Best Hits

Swiss-Prot: 99% identical to RS13_BIFLD: 30S ribosomal protein S13 (rpsM) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K02952, small subunit ribosomal protein S13 (inferred from 97% identity to gva:HMPREF0424_0275)

MetaCyc: 56% identical to 30S ribosomal subunit protein S13 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S13p (S18e)" in subsystem Ribosome SSU bacterial

Protein Sequence (125 amino acids)

>BBR_RS18815 30S ribosomal protein S13 (Bifidobacterium breve UCC2003)
MARLAGVDIPNEKRIEIALTYIFGVGRTRAKETLAATGINPDIRVKDLTDEQLITLRDYL
EANYKIEGDLRREVDADIRRKIQINCYQGQRHRKGLPVRGQRTKTNARTRKGPKRTVAGK
KKATK