Protein Info for BBR_RS18810 in Bifidobacterium breve UCC2003

Annotation: 30S ribosomal protein S11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03632: ribosomal protein uS11
  • amino acids 14 to 129 (116 residues), 181.2 bits, E=3.8e-58
• PF00411: Ribosomal_S11
  • amino acids 22 to 131 (110 residues), 154 bits, E=8.8e-50

Best Hits

Swiss-Prot: 100% identical to RS11_BIFLS: 30S ribosomal protein S11 (rpsK) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K02948, small subunit ribosomal protein S11 (inferred from 97% identity to blt:Balat_0407)

MetaCyc: 55% identical to 30S ribosomal subunit protein S11 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S11p (S14e)" in subsystem Ribosome SSU bacterial

Protein Sequence (132 amino acids)

>BBR_RS18810 30S ribosomal protein S11 (Bifidobacterium breve UCC2003)
MAAPKQAARKPRRRDRKSVPVGQAHIKSTFNNTIISITDPSGAVVSWASGGDVGFKGSRK
STPYAAGMAAESAARKAMEHGVKKVDVFVKGPGSGRETAIRSLQSAGLEVGSITDVTPQA
HNGVRPPKRRRV