Protein Info for BBR_RS18805 in Bifidobacterium breve UCC2003

Annotation: DNA-directed RNA polymerase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR02027: DNA-directed RNA polymerase, alpha subunit" amino acids 19 to 310 (292 residues), 378.5 bits, see alignment E=1.1e-117 PF01193: RNA_pol_L" amino acids 24 to 218 (195 residues), 73.1 bits, see alignment E=1.9e-24 PF01000: RNA_pol_A_bac" amino acids 54 to 169 (116 residues), 127.4 bits, see alignment E=5.2e-41 PF03118: RNA_pol_A_CTD" amino acids 242 to 302 (61 residues), 93.3 bits, see alignment E=9.1e-31

Best Hits

Swiss-Prot: 98% identical to RPOA_BIFLO: DNA-directed RNA polymerase subunit alpha (rpoA) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03040, DNA-directed RNA polymerase subunit alpha [EC: 2.7.7.6] (inferred from 98% identity to blb:BBMN68_1641)

Predicted SEED Role

"DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>BBR_RS18805 DNA-directed RNA polymerase subunit alpha (Bifidobacterium breve UCC2003)
MLIAQRPTLTEESLNPQRSRFTIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSVRISGAL
HEFTTLPGVQEDVTEILLNIKGIVLTSEYDEPVVMYLRKSGKGEATAGDITPPSGVTIAN
PEQHIATLAEDGELEIEFTVERGRGYVPAQMNKQDTDEIGRIPVDSIYSPVLKVSYKVEA
TRVEQRTDFDKLILDVETKPAISPRDAVASAGSTLVELFGLCRELNAQAEGVEVGPAPVA
EETNPEMAVPIEDLNLTQRSYNCLKREGVHTIGELVSHTEQDLLDIRNFGMKSIDEVKEK
LQTLGLSLKSSPMAFDTNNLEGGTFFSPEDE