Protein Info for BBR_RS18765 in Bifidobacterium breve UCC2003

Annotation: transcription termination/antitermination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR01953: transcription termination factor NusA" amino acids 8 to 330 (323 residues), 318 bits, see alignment E=3.5e-99 PF08529: NusA_N" amino acids 9 to 110 (102 residues), 50.9 bits, see alignment E=1.8e-17 PF13184: KH_5" amino acids 218 to 285 (68 residues), 74.6 bits, see alignment E=5.5e-25

Best Hits

KEGG orthology group: K02600, N utilization substance protein A (inferred from 93% identity to blo:BL1615)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>BBR_RS18765 transcription termination/antitermination protein NusA (Bifidobacterium breve UCC2003)
MELDLTGMHKLAAEQGIDPETLDDALAEALRLAYLKTPHAAKHARVELDERAGSFTVWAA
DDIPVEPTEDDPHPAPELGEEYDDTPHDFGRLAAATARQVITQLFRKVEDEKVFGAFSGQ
KGRLVTGIIQQDASDPTNVHVAMGEVEAILPRREQVPGERYRHGERIRVYVVNVARGIKG
PEIVVSRSHPELVRKLFEREVPELVSGAVSIMAIAREAGARTKLAVKANTDGVNPKGALI
GPSGARVRAVMENLGPEKIDIVDYSDDPAKFVAAALSPAVATGVQVISEKNKTAIAFIHD
DQLSLAIGKEGQNARLAAKLTGWKIGIESAEAHAKKVAEEQAAEQAAAQGE