Protein Info for BBR_RS18760 in Bifidobacterium breve UCC2003

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 940 PF04760: IF2_N" amino acids 1 to 51 (51 residues), 44.9 bits, see alignment 2.4e-15 amino acids 352 to 397 (46 residues), 40.4 bits, see alignment 6.2e-14 TIGR00487: translation initiation factor IF-2" amino acids 344 to 939 (596 residues), 752 bits, see alignment E=5.3e-230 TIGR00231: small GTP-binding protein domain" amino acids 436 to 596 (161 residues), 106.2 bits, see alignment E=1.5e-34 PF01926: MMR_HSR1" amino acids 438 to 547 (110 residues), 35.1 bits, see alignment E=3.9e-12 PF00009: GTP_EFTU" amino acids 438 to 598 (161 residues), 119.1 bits, see alignment E=5.5e-38 PF00071: Ras" amino acids 439 to 597 (159 residues), 33.9 bits, see alignment E=6.9e-12 PF11987: IF-2" amino acids 716 to 830 (115 residues), 131.2 bits, see alignment E=5.4e-42

Best Hits

Swiss-Prot: 88% identical to IF2_BIFLD: Translation initiation factor IF-2 (infB) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 88% identity to blm:BLLJ_1646)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (940 amino acids)

>BBR_RS18760 translation initiation factor IF-2 (Bifidobacterium breve UCC2003)
MAKPRVYELAKDLNVDSKTVLEKLKDMGEFVKSASSTIEPPVARRLKAAFDKDDKGDAKP
AASAQKPAAKPAQHKPAAAATHQGAAPAAATPGPRPQAERPAAPAPARHNNQHDNGGRPS
RQGQGRPNGNRQGQGRPNGGQPGQHQNNRGGQGGSRPTAGGNASNAIPRPHAQGPRPGNN
PFSRKQGMHSPTPGDIPRPHPMARPTTEGGRGGRPGRPGQGQGQGRGGFRGGRPGQGGQG
GPRPGQWGHNRPGQGGAAQGGGARGGFRGGQGGGSNFQGGGAPSNGPARGGGRGGRGGTA
GAFGRQGGKSSKARKNRLAKRHEYEELKAPTIGGVRIPNGNGQTIRLRQGASLADLAEKI
NVNQAALVTVLFHLGQMATATQSLDEETFQILGEEIGWNIQLVSAEEEDKELLQQFDINL
DEEELQDDEDLKPRPPVVTVMGHVDHGKTRLLDTIRKTNVIAREAGGITQRIGAYQVTVD
LEGEPRKITFLDTPGHEAFTAMRARGAELTDVAILVVAADDGVMPQTVEAINHAQAAKVP
IVVAVNKIDVPGANPEKVRGQLTEFGLVPEEYGGDTMFVDISAKQGTNVDKLLEAVLLTA
DAELDLRANPDMDARGATVEARLDKGRGAVATVLVQSGTLHVGDAIVAGTSYGRVRAMLD
ENGRAMDAAGPSTPVQVLGLTSVPTAGDLFLVASDDRAARQIAEKRQATERAAQLAKRRK
VVSLEDFKKKFAESEIDMLNIVIKGDSSGSVEALEDSLMKIEVSDEVGIQVIHRGVGAIT
QNDVNLATVDKAVIIGFNVRPNRQVADLAEREGVEIKYYSVIYRAIEDIEASLKGMLKPE
YEEVVTSHSEIREIFRSSKFGNIAGVMVQDGEVKRGTKCRILRNGVATVNDLEISSLRRF
KDDVQSVKEGYEAGINLGTFNDIELGDIIETFEMQEVERK