Protein Info for BBR_RS18755 in Bifidobacterium breve UCC2003

Annotation: 30S ribosome-binding factor RbfA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR00082: ribosome-binding factor A" amino acids 4 to 115 (112 residues), 76.8 bits, see alignment E=9.4e-26 PF02033: RBFA" amino acids 7 to 114 (108 residues), 99.2 bits, see alignment E=8e-33

Best Hits

Swiss-Prot: 90% identical to RBFA_BIFLD: Ribosome-binding factor A (rbfA) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 89% identity to bll:BLJ_1714)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>BBR_RS18755 30S ribosome-binding factor RbfA (Bifidobacterium breve UCC2003)
MAGTNPRAARIAALIQRVVASSIEHELHDKRLSSITVTEVRVTNDLQIAKIYWTQLGHEG
HEDGERKRAQQALDQAKGHLRTLVGHKAGLRLTPQLRFVFDEVPGEAHEIEDILAMAKKR
DEDLARARATAHYAGDADPYKHDDEPEDEDLNDEEYSSDEE