Protein Info for BBR_RS18730 in Bifidobacterium breve UCC2003

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 9 to 223 (215 residues), 276.6 bits, E=6e-87
• PF06026: Rib_5-P_isom_A
  • amino acids 54 to 223 (170 residues), 217.5 bits, E=5e-69

Best Hits

Swiss-Prot: 98% identical to RPIA_BIFLS: Ribose-5-phosphate isomerase A (rpiA) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 97% identity to blj:BLD_1750)

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (9/12 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• Calvin-Benson-Bassham cycle (8/13 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• oxygenic photosynthesis (9/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (13/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (12/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (232 amino acids)

>BBR_RS18730 ribose-5-phosphate isomerase RpiA (Bifidobacterium breve UCC2003)
MDKAQQDALKKAAGIEAAKLIEDGMIAGLGTGSTVKFLVDELGRRHQEEGLEFTGVTTSR
RTQAQAESYGIKIVDIDDVDHIDVTIDGADEVDKNFNGIKGGGAALLWEKIVATNSNQIV
WIVDESKVVDTIGKFPLPVEVIPFGAGHVIKKFEERGYKPVLRLDAEGKEVRTDENNFVV
DLHLERIDHPQELAEDLINTVGVVEHGLFLNMVDKVIVGDPNGPRVMTNANK