Protein Info for BBR_RS18705 in Bifidobacterium breve UCC2003

Annotation: alpha-D-glucose phosphate-specific phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01132: phosphoglucomutase, alpha-D-glucose phosphate-specific
  • amino acids 2 to 557 (556 residues), 810.7 bits, E=2.7e-248
• PF02878: PGM_PMM_I
  • amino acids 39 to 186 (148 residues), 99.9 bits, E=2.1e-32
• PF02879: PGM_PMM_II
  • amino acids 216 to 325 (110 residues), 38 bits, E=4e-13
• PF02880: PGM_PMM_III
  • amino acids 332 to 453 (122 residues), 95.2 bits, E=5.9e-31
• PF00408: PGM_PMM_IV
  • amino acids 497 to 552 (56 residues), 30.1 bits, 8.1e-11

Best Hits

Swiss-Prot: 57% identical to PGM_KOMXY: Phosphoglucomutase (celB) from Komagataeibacter xylinus

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 98% identity to bll:BLJ_1703)

MetaCyc: 58% identical to phosphoglucomutase (Mycobacterium tuberculosis H37Rv)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen degradation I (7/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• D-galactose degradation I (Leloir pathway) (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• starch degradation III (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• chitin biosynthesis (5/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• colanic acid building blocks biosynthesis (4/11 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.2

Use Curated BLAST to search for 5.4.2.2

Protein Sequence (558 amino acids)

>BBR_RS18705 alpha-D-glucose phosphate-specific phosphoglucomutase (Bifidobacterium breve UCC2003)
MVANNAGQPATPADLINVDEVIGKYYDLVPDPSVPEQRVIFGTSGHRGSSLKTSFNEAHI
VAISQAIAEYRKKAGVTGPLYLGSDTHALSGPAKKTAIEVLVANGVHVRIDSRDDFVPTP
VVSQAILTHNRAADGTQRFEGEGLADGIVVTPSHNPPTDGGFKYDPVTGGPAPAETTNAI
AARANELLADYKNVKRVPYEEAIKSEYVEGFDFREHYVDDLENVIDFDVIRSSGVRLGID
PLGGASVNYWPLINEKYGLNIGVVRPEVDPTWRFMTIDHDGKIRMDPSSPYAMKGLVDEL
NGGAWDKYDLVGGTDPDADRHGIVCPNWGVMNPNHYIAVCVEYLFGGNRPGWPEGAAVGK
TLVSSSLIDRVAASINAKVLEVPVGFKWFVDPLFSGEVAFGGEESSGMSFLRKNGRVWTT
DKDGLIPDLLAAEITAKTGKNPAQLHQEQVERFGESWYKRVDTPTTLEQKAKFAALSGDD
VTASTLAGEDITAKLTEAPGNHAKIGGLKVTTKDNWFAARPSGTENIYKVYAESFVSPEA
LDKVLDEATEVVDKALGE