Protein Info for BBR_RS18700 in Bifidobacterium breve UCC2003

Annotation: PTS beta-glucoside transporter subunit EIIBCA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 transmembrane" amino acids 132 to 155 (24 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 321 to 345 (25 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details amino acids 425 to 444 (20 residues), see Phobius details amino acids 476 to 497 (22 residues), see Phobius details PF00367: PTS_EIIB" amino acids 8 to 41 (34 residues), 55.3 bits, see alignment (E = 5e-19) PF02378: PTS_EIIC" amino acids 127 to 423 (297 residues), 122 bits, see alignment E=4.4e-39 PF00358: PTS_EIIA_1" amino acids 550 to 672 (123 residues), 150.8 bits, see alignment E=2.3e-48 TIGR00830: PTS system, glucose subfamily, IIA component" amino acids 550 to 670 (121 residues), 132.8 bits, see alignment E=3.1e-43

Best Hits

KEGG orthology group: K02755, PTS system, beta-glucosides-specific IIA component [EC: 2.7.1.69] K02756, PTS system, beta-glucosides-specific IIB component [EC: 2.7.1.69] K02757, PTS system, beta-glucosides-specific IIC component (inferred from 99% identity to bln:Blon_2183)

Predicted SEED Role

"PTS system, beta-glucoside-specific IIB component (EC 2.7.1.69) / PTS system, beta-glucoside-specific IIC component / PTS system, beta-glucoside-specific IIA component" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (696 amino acids)

>BBR_RS18700 PTS beta-glucoside transporter subunit EIIBCA (Bifidobacterium breve UCC2003)
MSHQDDIKAIVTSVGGAANIKSLTHCATRLRFELNDAGKVDNAALDANKLVLGAVPQSGD
RYQVVIGGQVASVYEQIMHLPEMAGLGAGTVDDDADEPTDAEVKAAARSKARGKVAWLDS
FFEYLADSFRPILGVLLGASIIIALVNLCISLGLIPNDTATTGLVFVQAIWKGVFYFLPI
MVAYNAAKKLKVDPWLGGAIMGMLMTPQFASLSDTKTWGDAVKCVENTTLGTSSCTATVF
GLPMQLSDYSGNVFVPLLMVAVLAVVYHGLKKIIPDSVQMVFLPFFSMIIVGALTAFIIG
PIGVWAGNGLGAGLAWMNTHAPFIFAIAIPLLYPFLVPLGLHWPLNALMIMNINTLGYDF
IQGPMGVWNFACFGATAGVLFLSIRDKDKDMRQTSIGALAAGLLGGVSEPSLYGIHLRYK
LIYSRMLVGCGVGGVVIAVMGWLFPATVASGETVHGVTTTAFAFTSLLTVPVFNQMWVYG
VSIAVSFFTAMIMIIMLDYRTPEQKAEAKARAAAQSAKAVNGGDATTATATAAVAVADAP
AAAATATSAVFAPIAGHVVSLDDAGDPVFASRALGEGVGIEPVDGTVKAPVSGVLQTVAE
TGHAFGLKTDDGIEVLVHVGIDTVKMNGNGFVVNVAKGDRVNAGDLLATVDLDEVKKAGF
STTTLVTVLNTAALKSVTPKTDVNVAAGDEVIAIEQ