Protein Info for BBR_RS18670 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 102 to 127 (26 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 322 (230 residues), 52.7 bits, see alignment E=2.3e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 98% identity to bln:Blon_2176)

Predicted SEED Role

"Predicted galacto-N-biose-/lacto-N-biose I ABC transporter, permease component 1" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>BBR_RS18670 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MTASTTQAKGKAPRRAAAKPKRSGAQKRENRTGWAFMAPFAVLFAFVFILPIIWAIYSSF
FRQVTEGGGAYGGGELVNKFVGFQNFQYVITSGNFWSGVGRVLVYTLIQVPIMIIAALAL
AIVIDSFVVKHVTGFRLGYFLPYAIPGVVASIIWVYLYNGQISPIVKGLAAIGVNVDFFN
KNIVLGSMANITTWTFTGYNMLIFLAALQAIPHDLYEAARIDGANGWQIATKIKLPNVRG
AALLAMLLSIVGTIQLFNEPQIMSTADPGISKSYTPMMMAMSTSQGSITPSGDGPASAIA
IVMALIAGVLAVLYTLAERKVNE