Protein Info for BBR_RS18665 in Bifidobacterium breve UCC2003

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 221 to 245 (25 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 129 to 305 (177 residues), 65 bits, see alignment E=4e-22

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 98% identity to blf:BLIF_1692)

Predicted SEED Role

"Predicted galacto-N-biose-/lacto-N-biose I ABC transporter, permease component 2" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>BBR_RS18665 carbohydrate ABC transporter permease (Bifidobacterium breve UCC2003)
MSSATVEERARKKAERKLEKQRQAAQHDLPRSMRPSAAVKTLTVVLLVLVLIYFLFPIYW
AIIASTKTPAQMTGSNGMWFAVPLDQLPNAIATNYSKLLGWTRGNFWRWVLNSLIYSGVS
ALIGTIVSVMAGYATAKFNFRGKNAAIGVIMACMLMPAALLTIPQYSIFHTLHLTNTMLS
IIIPCCVSPFGFFLGRTYAQSSVPDELLEAARIDGASEARIFFTIVLRLLAPAMVTIFLF
LFVATWNNFVLPLMMVSSDTLKPVTLGLYGMVSLSTFTDRGALMMGALLGVLPVIVLFLG
LQRYWQSGLAAGAVKG