Protein Info for BBR_RS18655 in Bifidobacterium breve UCC2003

Annotation: aminoglycoside phosphotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01636: APH
  • amino acids 24 to 249 (226 residues), 78.3 bits, E=4.1e-26

Best Hits

Swiss-Prot: 90% identical to NAHK_BIFL2: N-acetylhexosamine 1-kinase (nahK) from Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b)

KEGG orthology group: None (inferred from 90% identity to blm:BLLJ_1622)

MetaCyc: 90% identical to N-acetylhexosamine kinase (Bifidobacterium longum)
N-acetylhexosamine 1-kinase. [EC: 2.7.1.162]

Predicted SEED Role

"N-acetylhexosamine 1-kinase" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.162

Protein Sequence (356 amino acids)

>BBR_RS18655 aminoglycoside phosphotransferase family protein (Bifidobacterium breve UCC2003)
MAANKETLFDIASHFALEGNIISVEPYGDGHINTTYLVVTDGPHYILQRMNTSIFPDTVN
LMRNVELVTSALKARGKETLDIVPTTSGATWEEIDGGAWRVYKFIEHTVSYNLVPNPDVF
REAGRAFGDFQNFLSGFDAGQLTETIAHFHDTPHRFEDFKAALASDKLGRAASCQPEIDF
YLAHADQYATVMDGLKDGSIPLRVTHNDTKLNNILMDATTGKARAIIDLDTIMPGSMLFD
FGDSIRFGASTALEDEKDLDKVHFSTELFRAYAEGFVGELRGSITEREAELLAFSGNLLT
MECGMRFLADYLEGDVYFATKYPEHNLVRTRTQIKLVQEMEQKVDETHAIVADIMK